PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G359952_P01
Common NameAGAMOUS, MADS35, ZEAMMB73_662134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 29267.2 Da    PI: 9.5438
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G359952_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF983.9e-314190150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
  GRMZM2G359952_P01 41 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 90
                       79***********************************************8 PP

2K-box97.32.3e-321092065100
              K-box   5 sgks.leeakaeslqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                        s++  ++e +a+++qqe++kL++ i++Lq  + R+++G++++++ l++L+q+e +Lek++ kiR++Knell+++++++qk+e +lq +n++L
  GRMZM2G359952_P01 109 SNSGtVAEVNAQYYQQESSKLRQMIHSLQnANTRNIVGDSIHTMGLRDLKQMEGKLEKAIIKIRARKNELLYAEVDYMQKREMDLQTDNMYL 200
                        33335999*********************9899*********************************************************** PP

              K-box  95 rkklee 100
                        r+k++e
  GRMZM2G359952_P01 201 RSKIAE 206
                        ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3473393IPR002100Transcription factor, MADS-box
SMARTSM004324.9E-403392IPR002100Transcription factor, MADS-box
CDDcd002652.58E-4734110No hitNo description
SuperFamilySSF554556.93E-3334106IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-333555IPR002100Transcription factor, MADS-box
PfamPF003191.1E-264289IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-335570IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-337091IPR002100Transcription factor, MADS-box
PfamPF014869.2E-22118204IPR002487Transcription factor, K-box
PROSITE profilePS5129712.219119210IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0009066anatomyanther
PO:0001007developmental stagepollen development stage
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MLNMMTDLSC GPSSKVKEQV AAAPTGSGDR QGQGRGKIEI KRIENTTNRQ VTFCKRRNGL  60
LKKAYELSVL CDAEVALVVF SSRGRLYEYA NNSVKSTIER YKKANSDSSN SGTVAEVNAQ  120
YYQQESSKLR QMIHSLQNAN TRNIVGDSIH TMGLRDLKQM EGKLEKAIIK IRARKNELLY  180
AEVDYMQKRE MDLQTDNMYL RSKIAESNET GQPAMHMTMG APPTSEYDHM APFDSRNFLQ  240
VSMPQHYSHQ LQPTTLQLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-2134120190Myocyte-specific enhancer factor 2A
3p57_I4e-2134120190Myocyte-specific enhancer factor 2A
3p57_D4e-2134120190Myocyte-specific enhancer factor 2A
3p57_C4e-2134120190Myocyte-specific enhancer factor 2A
3p57_B4e-2134120190Myocyte-specific enhancer factor 2A
3p57_A4e-2134120190Myocyte-specific enhancer factor 2A
3kov_J4e-2134120190Myocyte-specific enhancer factor 2A
3kov_I4e-2134120190Myocyte-specific enhancer factor 2A
3kov_B4e-2134120190Myocyte-specific enhancer factor 2A
3kov_A4e-2134120190Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.673780.0pollen
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G359952
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G359952_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEAGAMOU0.0L81162.2 Zea mays AGAMOUS-like protein (AGAMOUS) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105946.10.0AGAMOUS-like protein
SwissprotQ407041e-137MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLO240090.0O24009_MAIZE; AGAMOUS-like protein
STRINGGRMZM2G359952_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-102MIKC_MADS family protein
Publications ? help Back to Top
  1. Theissen G,Strater T,Fischer A,Saedler H
    Structural characterization, chromosomal localization and phylogenetic evaluation of two pairs of AGAMOUS-like MADS-box genes from maize.
    Gene, 1995. 156(2): p. 155-66
    [PMID:7758952]